Anti KCTD16 pAb (ATL-HPA050154)
Atlas Antibodies
- SKU:
- ATL-HPA050154-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: KCTD16
Alternative Gene Name: KIAA1317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051401: 96%, ENSRNOG00000003848: 27%
Entrez Gene ID: 57528
Uniprot ID: Q68DU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS |
Gene Sequence | PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS |
Gene ID - Mouse | ENSMUSG00000051401 |
Gene ID - Rat | ENSRNOG00000003848 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KCTD16 pAb (ATL-HPA050154) | |
Datasheet | Anti KCTD16 pAb (ATL-HPA050154) Datasheet (External Link) |
Vendor Page | Anti KCTD16 pAb (ATL-HPA050154) at Atlas Antibodies |
Documents & Links for Anti KCTD16 pAb (ATL-HPA050154) | |
Datasheet | Anti KCTD16 pAb (ATL-HPA050154) Datasheet (External Link) |
Vendor Page | Anti KCTD16 pAb (ATL-HPA050154) |