Anti KCTD16 pAb (ATL-HPA050154)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050154-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KCTD16
Alternative Gene Name: KIAA1317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051401: 96%, ENSRNOG00000003848: 27%
Entrez Gene ID: 57528
Uniprot ID: Q68DU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS |
| Gene Sequence | PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS |
| Gene ID - Mouse | ENSMUSG00000051401 |
| Gene ID - Rat | ENSRNOG00000003848 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCTD16 pAb (ATL-HPA050154) | |
| Datasheet | Anti KCTD16 pAb (ATL-HPA050154) Datasheet (External Link) |
| Vendor Page | Anti KCTD16 pAb (ATL-HPA050154) at Atlas Antibodies |
| Documents & Links for Anti KCTD16 pAb (ATL-HPA050154) | |
| Datasheet | Anti KCTD16 pAb (ATL-HPA050154) Datasheet (External Link) |
| Vendor Page | Anti KCTD16 pAb (ATL-HPA050154) |