Anti KCTD16 pAb (ATL-HPA050154)

Atlas Antibodies

SKU: ATL-HPA050154-25

• 
• 
• 

Protein Description: potassium channel tetramerization domain containing 16
Gene Name: KCTD16
Alternative Gene Name: KIAA1317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051401: 96%, ENSRNOG00000003848: 27%
Entrez Gene ID: 57528
Uniprot ID: Q68DU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS
• Gene Sequence: PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS
• Gene ID - Mouse: ENSMUSG00000051401
• Gene ID - Rat: ENSRNOG00000003848
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.