Anti KCTD13 pAb (ATL-HPA043524 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043524-25

Protein Description: potassium channel tetramerization domain containing 13
Gene Name: KCTD13
Alternative Gene Name: FKSG86, PDIP1, POLDIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030685: 97%, ENSRNOG00000020010: 97%
Entrez Gene ID: 253980
Uniprot ID: Q8WZ19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD
• Gene Sequence: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD
• Gene ID - Mouse: ENSMUSG00000030685
• Gene ID - Rat: ENSRNOG00000020010
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCTD13 pAb (ATL-HPA043524 w/enhanced validation) – 2 Found

Escamilla, Christine Ochoa; Filonova, Irina; Walker, Angela K; Xuan, Zhong X; Holehonnur, Roopashri; Espinosa, Felipe; Liu, Shunan; Thyme, Summer B; López-García, Isabel A; Mendoza, Dorian B; Usui, Noriyoshi; Ellegood, Jacob; Eisch, Amelia J; Konopka, Genevieve; Lerch, Jason P; Schier, Alexander F; Speed, Haley E; Powell, Craig M. Kctd13 deletion reduces synaptic transmission via increased RhoA. Nature. 2017;551(7679):227-231. 

Martin Lorenzo, Sandra; Nalesso, Valérie; Chevalier, Claire; Birling, Marie-Christine; Herault, Yann. Targeting the RHOA pathway improves learning and memory in adult Kctd13 and 16p11.2 deletion mouse models. Molecular Autism. 2021;12(1):1.