Anti KCNK1 pAb (ATL-HPA016049)

Atlas Antibodies

SKU:
ATL-HPA016049-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: potassium channel, subfamily K, member 1
Gene Name: KCNK1
Alternative Gene Name: DPK, K2p1.1, TWIK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033998: 73%, ENSRNOG00000019937: 82%
Entrez Gene ID: 3775
Uniprot ID: O00180
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Gene Sequence YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Gene ID - Mouse ENSMUSG00000033998
Gene ID - Rat ENSRNOG00000019937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KCNK1 pAb (ATL-HPA016049)
Datasheet Anti KCNK1 pAb (ATL-HPA016049) Datasheet (External Link)
Vendor Page Anti KCNK1 pAb (ATL-HPA016049) at Atlas Antibodies

Documents & Links for Anti KCNK1 pAb (ATL-HPA016049)
Datasheet Anti KCNK1 pAb (ATL-HPA016049) Datasheet (External Link)
Vendor Page Anti KCNK1 pAb (ATL-HPA016049)



Citations for Anti KCNK1 pAb (ATL-HPA016049) – 1 Found
Zhao, Ke-Qing; Xiong, Guoxiang; Wilber, Morgan; Cohen, Noam A; Kreindler, James L. A role for two-pore K⁺ channels in modulating Na⁺ absorption and Cl⁻ secretion in normal human bronchial epithelial cells. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2012;302(1):L4-L12.  PubMed