Anti KCNJ5 pAb (ATL-HPA017353 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017353-100

Protein Description: potassium inwardly-rectifying channel, subfamily J, member 5
Gene Name: KCNJ5
Alternative Gene Name: CIR, GIRK4, KATP1, Kir3.4, LQT13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032034: 89%, ENSRNOG00000033796: 89%
Entrez Gene ID: 3762
Uniprot ID: P48544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY
• Gene Sequence: VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY
• Gene ID - Mouse: ENSMUSG00000032034
• Gene ID - Rat: ENSRNOG00000033796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNJ5 pAb (ATL-HPA017353 w/enhanced validation) – 4 Found

Hardege, Iris; Xu, Shengxin; Gordon, Richard D; Thompson, Andrew J; Figg, Nichola; Stowasser, Michael; Murrell-Lagnado, Ruth; O'Shaughnessy, Kevin M. Novel Insertion Mutation in KCNJ5 Channel Produces Constitutive Aldosterone Release From H295R Cells. Molecular Endocrinology (Baltimore, Md.). 2015;29(10):1522-30. 

Azizan, Elena A B; Poulsen, Hanne; Tuluc, Petronel; Zhou, Junhua; Clausen, Michael V; Lieb, Andreas; Maniero, Carmela; Garg, Sumedha; Bochukova, Elena G; Zhao, Wanfeng; Shaikh, Lalarukh Haris; Brighton, Cheryl A; Teo, Ada E D; Davenport, Anthony P; Dekkers, Tanja; Tops, Bas; Küsters, Benno; Ceral, Jiri; Yeo, Giles S H; Neogi, Sudeshna Guha; McFarlane, Ian; Rosenfeld, Nitzan; Marass, Francesco; Hadfield, James; Margas, Wojciech; Chaggar, Kanchan; Solar, Miroslav; Deinum, Jaap; Dolphin, Annette C; Farooqi, I Sadaf; Striessnig, Joerg; Nissen, Poul; Brown, Morris J. Somatic mutations in ATP1A1 and CACNA1D underlie a common subtype of adrenal hypertension. Nature Genetics. 2013;45(9):1055-60. 

Zhou, Junhua; Shaikh, Lalarukh Haris; Neogi, Sudeshna G; McFarlane, Ian; Zhao, Wanfeng; Figg, Nichola; Brighton, Cheryl A; Maniero, Carmela; Teo, Ada E D; Azizan, Elena A B; Brown, Morris J. DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion. Hypertension (Dallas, Tex. : 1979). 2015;65(5):1103-10. 

Hardege, Iris; Long, Lu; Al Maskari, Raya; Figg, Nicola; O'Shaughnessy, Kevin M. Targeted disruption of the Kcnj5 gene in the female mouse lowers aldosterone levels. Clinical Science (London, England : 1979). 2018;132(1):145-156.