Anti KCNJ5 pAb (ATL-HPA014722)

Atlas Antibodies

Catalog No.: ATL-HPA014722-25

Protein Description: potassium inwardly-rectifying channel, subfamily J, member 5
Gene Name: KCNJ5
Alternative Gene Name: CIR, GIRK4, KATP1, Kir3.4, LQT13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032034: 88%, ENSRNOG00000033796: 85%
Entrez Gene ID: 3762
Uniprot ID: P48544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG
• Gene Sequence: TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG
• Gene ID - Mouse: ENSMUSG00000032034
• Gene ID - Rat: ENSRNOG00000033796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.