Anti KCNH1 pAb (ATL-HPA014551)

Atlas Antibodies

Catalog No.: ATL-HPA014551-25

Protein Description: potassium channel, voltage gated eag related subfamily H, member 1
Gene Name: KCNH1
Alternative Gene Name: eag, eag1, h-eag, Kv10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058248: 91%, ENSRNOG00000003841: 92%
Entrez Gene ID: 3756
Uniprot ID: O95259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
• Gene Sequence: DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
• Gene ID - Mouse: ENSMUSG00000058248
• Gene ID - Rat: ENSRNOG00000003841
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.