Anti KCNE5 pAb (ATL-HPA042316)

Atlas Antibodies

Catalog No.: ATL-HPA042316-25

Protein Description: potassium channel, voltage gated subfamily E regulatory beta subunit 5
Gene Name: KCNE5
Alternative Gene Name: KCNE1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090122: 88%, ENSRNOG00000019176: 88%
Entrez Gene ID: 23630
Uniprot ID: Q9UJ90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDA
• Gene Sequence: MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDA
• Gene ID - Mouse: ENSMUSG00000090122
• Gene ID - Rat: ENSRNOG00000019176
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.