Anti KCNE3 pAb (ATL-HPA014849)

Atlas Antibodies

Catalog No.:
ATL-HPA014849-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel, Isk-related family, member 3
Gene Name: KCNE3
Alternative Gene Name: HOKPP, MiRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035165: 88%, ENSRNOG00000017054: 80%
Entrez Gene ID: 10008
Uniprot ID: Q9Y6H6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
Gene Sequence METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
Gene ID - Mouse ENSMUSG00000035165
Gene ID - Rat ENSRNOG00000017054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNE3 pAb (ATL-HPA014849)
Datasheet Anti KCNE3 pAb (ATL-HPA014849) Datasheet (External Link)
Vendor Page Anti KCNE3 pAb (ATL-HPA014849) at Atlas Antibodies

Documents & Links for Anti KCNE3 pAb (ATL-HPA014849)
Datasheet Anti KCNE3 pAb (ATL-HPA014849) Datasheet (External Link)
Vendor Page Anti KCNE3 pAb (ATL-HPA014849)