Anti KCNE3 pAb (ATL-HPA014849)

Atlas Antibodies

Catalog No.: ATL-HPA014849-25

Protein Description: potassium voltage-gated channel, Isk-related family, member 3
Gene Name: KCNE3
Alternative Gene Name: HOKPP, MiRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035165: 88%, ENSRNOG00000017054: 80%
Entrez Gene ID: 10008
Uniprot ID: Q9Y6H6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
• Gene Sequence: METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
• Gene ID - Mouse: ENSMUSG00000035165
• Gene ID - Rat: ENSRNOG00000017054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.