Anti KBTBD6 pAb (ATL-HPA048914)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048914-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: KBTBD6
Alternative Gene Name: DKFZp547E1912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075502: 97%, ENSRNOG00000047604: 98%
Entrez Gene ID: 89890
Uniprot ID: Q86V97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSM |
| Gene Sequence | TGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSM |
| Gene ID - Mouse | ENSMUSG00000075502 |
| Gene ID - Rat | ENSRNOG00000047604 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KBTBD6 pAb (ATL-HPA048914) | |
| Datasheet | Anti KBTBD6 pAb (ATL-HPA048914) Datasheet (External Link) |
| Vendor Page | Anti KBTBD6 pAb (ATL-HPA048914) at Atlas Antibodies |
| Documents & Links for Anti KBTBD6 pAb (ATL-HPA048914) | |
| Datasheet | Anti KBTBD6 pAb (ATL-HPA048914) Datasheet (External Link) |
| Vendor Page | Anti KBTBD6 pAb (ATL-HPA048914) |