Anti KBTBD6 pAb (ATL-HPA046861)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046861-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KBTBD6
Alternative Gene Name: DKFZp547E1912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043881: 80%, ENSRNOG00000047604: 80%
Entrez Gene ID: 89890
Uniprot ID: Q86V97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSS |
Gene Sequence | TVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSS |
Gene ID - Mouse | ENSMUSG00000043881 |
Gene ID - Rat | ENSRNOG00000047604 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KBTBD6 pAb (ATL-HPA046861) | |
Datasheet | Anti KBTBD6 pAb (ATL-HPA046861) Datasheet (External Link) |
Vendor Page | Anti KBTBD6 pAb (ATL-HPA046861) at Atlas Antibodies |
Documents & Links for Anti KBTBD6 pAb (ATL-HPA046861) | |
Datasheet | Anti KBTBD6 pAb (ATL-HPA046861) Datasheet (External Link) |
Vendor Page | Anti KBTBD6 pAb (ATL-HPA046861) |