Anti KBTBD2 pAb (ATL-HPA021133)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021133-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KBTBD2
Alternative Gene Name: BKLHD1, DKFZP566C134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059486: 100%, ENSRNOG00000013809: 100%
Entrez Gene ID: 25948
Uniprot ID: Q8IY47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPNDKSVVVQGLYKSMPKFFKPRLGMTKEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCSPPADLHKVGTVVTPDND |
| Gene Sequence | LNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPNDKSVVVQGLYKSMPKFFKPRLGMTKEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCSPPADLHKVGTVVTPDND |
| Gene ID - Mouse | ENSMUSG00000059486 |
| Gene ID - Rat | ENSRNOG00000013809 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KBTBD2 pAb (ATL-HPA021133) | |
| Datasheet | Anti KBTBD2 pAb (ATL-HPA021133) Datasheet (External Link) |
| Vendor Page | Anti KBTBD2 pAb (ATL-HPA021133) at Atlas Antibodies |
| Documents & Links for Anti KBTBD2 pAb (ATL-HPA021133) | |
| Datasheet | Anti KBTBD2 pAb (ATL-HPA021133) Datasheet (External Link) |
| Vendor Page | Anti KBTBD2 pAb (ATL-HPA021133) |