Anti KAZALD1 pAb (ATL-HPA011800)

Atlas Antibodies

Catalog No.:
ATL-HPA011800-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Kazal-type serine peptidase inhibitor domain 1
Gene Name: KAZALD1
Alternative Gene Name: FKSG28, FKSG40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025213: 87%, ENSRNOG00000016058: 88%
Entrez Gene ID: 81621
Uniprot ID: Q96I82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPE
Gene Sequence IFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPE
Gene ID - Mouse ENSMUSG00000025213
Gene ID - Rat ENSRNOG00000016058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KAZALD1 pAb (ATL-HPA011800)
Datasheet Anti KAZALD1 pAb (ATL-HPA011800) Datasheet (External Link)
Vendor Page Anti KAZALD1 pAb (ATL-HPA011800) at Atlas Antibodies

Documents & Links for Anti KAZALD1 pAb (ATL-HPA011800)
Datasheet Anti KAZALD1 pAb (ATL-HPA011800) Datasheet (External Link)
Vendor Page Anti KAZALD1 pAb (ATL-HPA011800)