Anti KAT2B pAb (ATL-HPA055839)

Atlas Antibodies

Catalog No.:
ATL-HPA055839-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: K(lysine) acetyltransferase 2B
Gene Name: KAT2B
Alternative Gene Name: GCN5, GCN5L, P/CAF, PCAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000708: 94%, ENSRNOG00000018364: 59%
Entrez Gene ID: 8850
Uniprot ID: Q92831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY
Gene Sequence KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY
Gene ID - Mouse ENSMUSG00000000708
Gene ID - Rat ENSRNOG00000018364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KAT2B pAb (ATL-HPA055839)
Datasheet Anti KAT2B pAb (ATL-HPA055839) Datasheet (External Link)
Vendor Page Anti KAT2B pAb (ATL-HPA055839) at Atlas Antibodies

Documents & Links for Anti KAT2B pAb (ATL-HPA055839)
Datasheet Anti KAT2B pAb (ATL-HPA055839) Datasheet (External Link)
Vendor Page Anti KAT2B pAb (ATL-HPA055839)