Anti KANSL1 pAb (ATL-HPA007208)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007208-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KANSL1
Alternative Gene Name: CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018412: 93%, ENSRNOG00000053680: 95%
Entrez Gene ID: 284058
Uniprot ID: Q7Z3B3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGKRALTSSALHGGEMGGSESGDLK |
| Gene Sequence | LGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGKRALTSSALHGGEMGGSESGDLK |
| Gene ID - Mouse | ENSMUSG00000018412 |
| Gene ID - Rat | ENSRNOG00000053680 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KANSL1 pAb (ATL-HPA007208) | |
| Datasheet | Anti KANSL1 pAb (ATL-HPA007208) Datasheet (External Link) |
| Vendor Page | Anti KANSL1 pAb (ATL-HPA007208) at Atlas Antibodies |
| Documents & Links for Anti KANSL1 pAb (ATL-HPA007208) | |
| Datasheet | Anti KANSL1 pAb (ATL-HPA007208) Datasheet (External Link) |
| Vendor Page | Anti KANSL1 pAb (ATL-HPA007208) |