Anti KANSL1 pAb (ATL-HPA007208)

Atlas Antibodies

Catalog No.: ATL-HPA007208-25

Protein Description: KAT8 regulatory NSL complex subunit 1
Gene Name: KANSL1
Alternative Gene Name: CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018412: 93%, ENSRNOG00000053680: 95%
Entrez Gene ID: 284058
Uniprot ID: Q7Z3B3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGKRALTSSALHGGEMGGSESGDLK
• Gene Sequence: LGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGKRALTSSALHGGEMGGSESGDLK
• Gene ID - Mouse: ENSMUSG00000018412
• Gene ID - Rat: ENSRNOG00000053680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.