Anti KANSL1 pAb (ATL-HPA006874)

Atlas Antibodies

Catalog No.: ATL-HPA006874-25

Protein Description: KAT8 regulatory NSL complex subunit 1
Gene Name: KANSL1
Alternative Gene Name: CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018412: 90%, ENSRNOG00000053680: 55%
Entrez Gene ID: 284058
Uniprot ID: Q7Z3B3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS
• Gene Sequence: APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS
• Gene ID - Mouse: ENSMUSG00000018412
• Gene ID - Rat: ENSRNOG00000053680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KANSL1 pAb (ATL-HPA006874) – 3 Found

Linda, Katrin; Lewerissa, Elly I; Verboven, Anouk H A; Gabriele, Michele; Frega, Monica; Klein Gunnewiek, Teun M; Devilee, Lynn; Ulferts, Edda; Hommersom, Marina; Oudakker, Astrid; Schoenmaker, Chantal; van Bokhoven, Hans; Schubert, Dirk; Testa, Giuseppe; Koolen, David A; de Vries, Bert B A; Nadif Kasri, Nael. Imbalanced autophagy causes synaptic deficits in a human model for neurodevelopmental disorders. Autophagy. 2022;18(2):423-442. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Soutar, Marc P M; Melandri, Daniela; O'Callaghan, Benjamin; Annuario, Emily; Monaghan, Amy E; Welsh, Natalie J; D'Sa, Karishma; Guelfi, Sebastian; Zhang, David; Pittman, Alan; Trabzuni, Daniah; Verboven, Anouk H A; Pan, Kylie S; Kia, Demis A; Bictash, Magda; Gandhi, Sonia; Houlden, Henry; Cookson, Mark R; Kasri, Nael Nadif; Wood, Nicholas W; Singleton, Andrew B; Hardy, John; Whiting, Paul J; Blauwendraat, Cornelis; Whitworth, Alexander J; Manzoni, Claudia; Ryten, Mina; Lewis, Patrick A; Plun-Favreau, Hélène. Regulation of mitophagy by the NSL complex underlies genetic risk for Parkinson's disease at 16q11.2 and MAPT H1 loci. Brain : A Journal Of Neurology. 2022;145(12):4349-4367.