Anti JUND pAb (ATL-HPA063029)

Atlas Antibodies

Catalog No.: ATL-HPA063029-100

Protein Description: jun D proto-oncogene
Gene Name: JUND
Alternative Gene Name: AP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110974: 98%, ENSRNOG00000019568: 98%
Entrez Gene ID: 3727
Uniprot ID: P17535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED
• Gene Sequence: IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED
• Gene ID - Mouse: ENSMUSG00000110974
• Gene ID - Rat: ENSRNOG00000019568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.