Anti JUN pAb (ATL-HPA059474)

Atlas Antibodies

Catalog No.:
ATL-HPA059474-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: jun proto-oncogene
Gene Name: JUN
Alternative Gene Name: AP-1, c-Jun
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052684: 97%, ENSRNOG00000026293: 95%
Entrez Gene ID: 3725
Uniprot ID: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
Gene Sequence METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
Gene ID - Mouse ENSMUSG00000052684
Gene ID - Rat ENSRNOG00000026293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JUN pAb (ATL-HPA059474)
Datasheet Anti JUN pAb (ATL-HPA059474) Datasheet (External Link)
Vendor Page Anti JUN pAb (ATL-HPA059474) at Atlas Antibodies

Documents & Links for Anti JUN pAb (ATL-HPA059474)
Datasheet Anti JUN pAb (ATL-HPA059474) Datasheet (External Link)
Vendor Page Anti JUN pAb (ATL-HPA059474)
Citations for Anti JUN pAb (ATL-HPA059474) – 2 Found
Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732.  PubMed
Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.  PubMed