Anti JUN pAb (ATL-HPA059474)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059474-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: JUN
Alternative Gene Name: AP-1, c-Jun
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052684: 97%, ENSRNOG00000026293: 95%
Entrez Gene ID: 3725
Uniprot ID: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
| Gene Sequence | METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
| Gene ID - Mouse | ENSMUSG00000052684 |
| Gene ID - Rat | ENSRNOG00000026293 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti JUN pAb (ATL-HPA059474) | |
| Datasheet | Anti JUN pAb (ATL-HPA059474) Datasheet (External Link) |
| Vendor Page | Anti JUN pAb (ATL-HPA059474) at Atlas Antibodies |
| Documents & Links for Anti JUN pAb (ATL-HPA059474) | |
| Datasheet | Anti JUN pAb (ATL-HPA059474) Datasheet (External Link) |
| Vendor Page | Anti JUN pAb (ATL-HPA059474) |
| Citations for Anti JUN pAb (ATL-HPA059474) – 2 Found |
| Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732. PubMed |
| Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469. PubMed |