Anti JUN pAb (ATL-HPA059474)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059474-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: JUN
Alternative Gene Name: AP-1, c-Jun
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052684: 97%, ENSRNOG00000026293: 95%
Entrez Gene ID: 3725
Uniprot ID: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
Gene Sequence | METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
Gene ID - Mouse | ENSMUSG00000052684 |
Gene ID - Rat | ENSRNOG00000026293 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti JUN pAb (ATL-HPA059474) | |
Datasheet | Anti JUN pAb (ATL-HPA059474) Datasheet (External Link) |
Vendor Page | Anti JUN pAb (ATL-HPA059474) at Atlas Antibodies |
Documents & Links for Anti JUN pAb (ATL-HPA059474) | |
Datasheet | Anti JUN pAb (ATL-HPA059474) Datasheet (External Link) |
Vendor Page | Anti JUN pAb (ATL-HPA059474) |
Citations for Anti JUN pAb (ATL-HPA059474) – 2 Found |
Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732. PubMed |
Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469. PubMed |