Anti JUN pAb (ATL-HPA059474)

Atlas Antibodies

Catalog No.: ATL-HPA059474-25

Protein Description: jun proto-oncogene
Gene Name: JUN
Alternative Gene Name: AP-1, c-Jun
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052684: 97%, ENSRNOG00000026293: 95%
Entrez Gene ID: 3725
Uniprot ID: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
• Gene Sequence: METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
• Gene ID - Mouse: ENSMUSG00000052684
• Gene ID - Rat: ENSRNOG00000026293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti JUN pAb (ATL-HPA059474) – 2 Found

Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732. 

Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.