Anti JUN pAb (ATL-HPA031174)

Atlas Antibodies

Catalog No.: ATL-HPA031174-100

Protein Description: Jun proto-oncogene, AP-1 transcription factor subunit
Gene Name: JUN
Alternative Gene Name: AP-1, c-Jun
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052684: 94%, ENSRNOG00000026293: 93%
Entrez Gene ID: 3725
Uniprot ID: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQE
• Gene Sequence: ANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQE
• Gene ID - Mouse: ENSMUSG00000052684
• Gene ID - Rat: ENSRNOG00000026293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.