Anti JRKL pAb (ATL-HPA046184)

Atlas Antibodies

Catalog No.:
ATL-HPA046184-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: JRK-like
Gene Name: JRKL
Alternative Gene Name: HHMJG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079083: 90%, ENSRNOG00000047133: 89%
Entrez Gene ID: 8690
Uniprot ID: Q9Y4A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQHTKGLENVTTENLEKWLEVDSTEPGYEVLTDSEIIRRAQGQADESSENEEEEIELIPEKHINHAAALQ
Gene Sequence LQHTKGLENVTTENLEKWLEVDSTEPGYEVLTDSEIIRRAQGQADESSENEEEEIELIPEKHINHAAALQ
Gene ID - Mouse ENSMUSG00000079083
Gene ID - Rat ENSRNOG00000047133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JRKL pAb (ATL-HPA046184)
Datasheet Anti JRKL pAb (ATL-HPA046184) Datasheet (External Link)
Vendor Page Anti JRKL pAb (ATL-HPA046184) at Atlas Antibodies

Documents & Links for Anti JRKL pAb (ATL-HPA046184)
Datasheet Anti JRKL pAb (ATL-HPA046184) Datasheet (External Link)
Vendor Page Anti JRKL pAb (ATL-HPA046184)