Anti JAG2 pAb (ATL-HPA030636)

Atlas Antibodies

Catalog No.:
ATL-HPA030636-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: jagged 2
Gene Name: JAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002799: 99%, ENSRNOG00000007443: 54%
Entrez Gene ID: 3714
Uniprot ID: Q9Y219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS
Gene Sequence LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS
Gene ID - Mouse ENSMUSG00000002799
Gene ID - Rat ENSRNOG00000007443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JAG2 pAb (ATL-HPA030636)
Datasheet Anti JAG2 pAb (ATL-HPA030636) Datasheet (External Link)
Vendor Page Anti JAG2 pAb (ATL-HPA030636) at Atlas Antibodies

Documents & Links for Anti JAG2 pAb (ATL-HPA030636)
Datasheet Anti JAG2 pAb (ATL-HPA030636) Datasheet (External Link)
Vendor Page Anti JAG2 pAb (ATL-HPA030636)