Anti ITSN1 pAb (ATL-HPA018007)

Atlas Antibodies

Catalog No.: ATL-HPA018007-25

Protein Description: intersectin 1 (SH3 domain protein)
Gene Name: ITSN1
Alternative Gene Name: ITSN, MGC134948, MGC134949, SH3D1A, SH3P17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022957: 91%, ENSRNOG00000002001: 87%
Entrez Gene ID: 6453
Uniprot ID: Q15811
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
• Gene Sequence: ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
• Gene ID - Mouse: ENSMUSG00000022957
• Gene ID - Rat: ENSRNOG00000002001
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITSN1 pAb (ATL-HPA018007) – 1 Found

Wang, Xinxin; Chen, Zhiming; Mettlen, Marcel; Noh, Jungsik; Schmid, Sandra L; Danuser, Gaudenz. DASC, a sensitive classifier for measuring discrete early stages in clathrin-mediated endocytosis. Elife. 2020;9( 32352376)