Anti ITPR1 pAb (ATL-HPA014765)

Atlas Antibodies

Catalog No.: ATL-HPA014765-100

Protein Description: inositol 1,4,5-trisphosphate receptor, type 1
Gene Name: ITPR1
Alternative Gene Name: ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030102: 91%, ENSRNOG00000007104: 89%
Entrez Gene ID: 3708
Uniprot ID: Q14643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
• Gene Sequence: KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
• Gene ID - Mouse: ENSMUSG00000030102
• Gene ID - Rat: ENSRNOG00000007104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.