Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003948-25

Protein Description: inter-alpha-trypsin inhibitor heavy chain family, member 4
Gene Name: ITIH4
Alternative Gene Name: H4P, IHRP, ITIHL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021922: 35%, ENSRNOG00000017381: 36%
Entrez Gene ID: 3700
Uniprot ID: Q14624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
• Gene Sequence: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
• Gene ID - Mouse: ENSMUSG00000021922
• Gene ID - Rat: ENSRNOG00000017381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) – 1 Found

Kirkemo, Lisa L; Elledge, Susanna K; Yang, Jiuling; Byrnes, James R; Glasgow, Jeff E; Blelloch, Robert; Wells, James A. Cell-surface tethered promiscuous biotinylators enable comparative small-scale surface proteomic analysis of human extracellular vesicles and cells. Elife. 2022;11( 35257663)