Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003948-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ITIH4
Alternative Gene Name: H4P, IHRP, ITIHL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021922: 35%, ENSRNOG00000017381: 36%
Entrez Gene ID: 3700
Uniprot ID: Q14624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA |
| Gene Sequence | LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA |
| Gene ID - Mouse | ENSMUSG00000021922 |
| Gene ID - Rat | ENSRNOG00000017381 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) | |
| Datasheet | Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) | |
| Datasheet | Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) |
| Citations for Anti ITIH4 pAb (ATL-HPA003948 w/enhanced validation) – 1 Found |
| Kirkemo, Lisa L; Elledge, Susanna K; Yang, Jiuling; Byrnes, James R; Glasgow, Jeff E; Blelloch, Robert; Wells, James A. Cell-surface tethered promiscuous biotinylators enable comparative small-scale surface proteomic analysis of human extracellular vesicles and cells. Elife. 2022;11( 35257663) PubMed |