Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031171-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Gene Name: ITGA2B
Alternative Gene Name: CD41, CD41B, GP2B, PPP1R93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034664: 77%, ENSRNOG00000022071: 77%
Entrez Gene ID: 3674
Uniprot ID: P08514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Gene Sequence FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Gene ID - Mouse ENSMUSG00000034664
Gene ID - Rat ENSRNOG00000022071
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation)
Datasheet Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation)
Datasheet Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation)