Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031168-25

Protein Description: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Gene Name: ITGA2B
Alternative Gene Name: CD41, CD41B, GP2B, PPP1R93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034664: 81%, ENSRNOG00000022071: 77%
Entrez Gene ID: 3674
Uniprot ID: P08514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
• Gene Sequence: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
• Gene ID - Mouse: ENSMUSG00000034664
• Gene ID - Rat: ENSRNOG00000022071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) – 2 Found

Vial, Guillaume; Rivière, Etienne; Raymond, Anne-Aurélie; James, Chloé; Di-Tommaso, Sylvaine; Dugot-Senant, Nathalie; Dupuy, Jean-William; Yacoub, Mokrane; Parrens, Marie; Saltel, Fréderic; Viallard, Jean-François. Antigenic Mimicry in Paraneoplastic Immune Thrombocytopenia. Frontiers In Immunology. 10( 30967864):523. 

Commerford, Catharina D; Dieterich, Lothar C; He, Yuliang; Hell, Tanja; Montoya-Zegarra, Javier A; Noerrelykke, Simon F; Russo, Erica; Röcken, Martin; Detmar, Michael. Mechanisms of Tumor-Induced Lymphovascular Niche Formation in Draining Lymph Nodes. Cell Reports. 2018;25(13):3554-3563.e4.