Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031168-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: ITGA2B
Alternative Gene Name: CD41, CD41B, GP2B, PPP1R93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034664: 81%, ENSRNOG00000022071: 77%
Entrez Gene ID: 3674
Uniprot ID: P08514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV |
| Gene Sequence | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV |
| Gene ID - Mouse | ENSMUSG00000034664 |
| Gene ID - Rat | ENSRNOG00000022071 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) | |
| Datasheet | Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) | |
| Datasheet | Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) |
| Citations for Anti ITGA2B pAb (ATL-HPA031168 w/enhanced validation) – 2 Found |
| Vial, Guillaume; Rivière, Etienne; Raymond, Anne-Aurélie; James, Chloé; Di-Tommaso, Sylvaine; Dugot-Senant, Nathalie; Dupuy, Jean-William; Yacoub, Mokrane; Parrens, Marie; Saltel, Fréderic; Viallard, Jean-François. Antigenic Mimicry in Paraneoplastic Immune Thrombocytopenia. Frontiers In Immunology. 10( 30967864):523. PubMed |
| Commerford, Catharina D; Dieterich, Lothar C; He, Yuliang; Hell, Tanja; Montoya-Zegarra, Javier A; Noerrelykke, Simon F; Russo, Erica; Röcken, Martin; Detmar, Michael. Mechanisms of Tumor-Induced Lymphovascular Niche Formation in Draining Lymph Nodes. Cell Reports. 2018;25(13):3554-3563.e4. PubMed |