Anti ISPD pAb (ATL-HPA043810)

Atlas Antibodies

Catalog No.: ATL-HPA043810-25

Protein Description: isoprenoid synthase domain containing
Gene Name: ISPD
Alternative Gene Name: hCG_1745121, IspD, Nip
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043153: 56%, ENSRNOG00000006199: 58%
Entrez Gene ID: 729920
Uniprot ID: A4D126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SELNHVKVTSEALGHAGRHLQQIILDQCYNFVCVNVTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQ
• Gene Sequence: SELNHVKVTSEALGHAGRHLQQIILDQCYNFVCVNVTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQ
• Gene ID - Mouse: ENSMUSG00000043153
• Gene ID - Rat: ENSRNOG00000006199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.