Anti ISL2 pAb (ATL-HPA075192)

Atlas Antibodies

SKU:
ATL-HPA075192-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to rods & rings.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ISL LIM homeobox 2
Gene Name: ISL2
Alternative Gene Name: FLJ10160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032318: 100%, ENSRNOG00000015336: 100%
Entrez Gene ID: 64843
Uniprot ID: Q96A47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
Gene Sequence MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
Gene ID - Mouse ENSMUSG00000032318
Gene ID - Rat ENSRNOG00000015336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ISL2 pAb (ATL-HPA075192)
Datasheet Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link)
Vendor Page Anti ISL2 pAb (ATL-HPA075192) at Atlas Antibodies

Documents & Links for Anti ISL2 pAb (ATL-HPA075192)
Datasheet Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link)
Vendor Page Anti ISL2 pAb (ATL-HPA075192)