Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004627-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ISG15
Alternative Gene Name: G1P2, IFI15, UCRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035692: 65%, ENSRNOG00000021802: 62%
Entrez Gene ID: 9636
Uniprot ID: P05161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLS |
| Gene Sequence | VKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLS |
| Gene ID - Mouse | ENSMUSG00000035692 |
| Gene ID - Rat | ENSRNOG00000021802 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) | |
| Datasheet | Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) | |
| Datasheet | Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) |
| Citations for Anti ISG15 pAb (ATL-HPA004627 w/enhanced validation) – 7 Found |
| Del Prete, Gregory Q; Alvord, W Gregory; Li, Yuan; Deleage, Claire; Nag, Mukta; Oswald, Kelli; Thomas, James A; Pyle, Cathi; Bosche, William J; Coalter, Vicky; Wiles, Adam; Wiles, Rodney; Berkemeier, Brian; Hull, Michael; Chipriano, Elizabeth; Silipino, Lorna; Fast, Randy; Kiser, Jacob; Kiser, Rebecca; Malys, Tyler; Kramer, Joshua; Breed, Matthew W; Trubey, Charles M; Estes, Jacob D; Barnes, Tiffany L; Hesselgesser, Joseph; Geleziunas, Romas; Lifson, Jeffrey D. TLR7 agonist administration to SIV-infected macaques receiving early initiated cART does not induce plasma viremia. Jci Insight. 2019;4(11) PubMed |
| Mukherjee, Rukmini; Bhattacharya, Anshu; Bojkova, Denisa; Mehdipour, Ahmad Reza; Shin, Donghyuk; Khan, Khadija Shahed; Hei-Yin Cheung, Hayley; Wong, Kam-Bo; Ng, Wai-Lung; Cinatl, Jindrich; Geurink, Paul P; van der Heden van Noort, Gerbrand J; Rajalingam, Krishnaraj; Ciesek, Sandra; Hummer, Gerhard; Dikic, Ivan. Famotidine inhibits toll-like receptor 3-mediated inflammatory signaling in SARS-CoV-2 infection. The Journal Of Biological Chemistry. 2021;297(2):100925. PubMed |
| Govindaraj, Padmanabha Kumar; Kallarakkal, Thomas George; Mohd Zain, Rosnah; Tilakaratne, Wanninayake Mudiyanselage; Lew, Huai Lin. Expression of Ki-67, Cornulin and ISG15 in non-involved mucosal surgical margins as predictive markers for relapse in oral squamous cell carcinoma (OSCC). Plos One. 16(12):e0261575. PubMed |
| Harris, Levelle D; Tabb, Brian; Sodora, Donald L; Paiardini, Mirko; Klatt, Nichole R; Douek, Daniel C; Silvestri, Guido; Müller-Trutwin, Michaela; Vasile-Pandrea, Ivona; Apetrei, Cristian; Hirsch, Vanessa; Lifson, Jeffrey; Brenchley, Jason M; Estes, Jacob D. Downregulation of robust acute type I interferon responses distinguishes nonpathogenic simian immunodeficiency virus (SIV) infection of natural hosts from pathogenic SIV infection of rhesus macaques. Journal Of Virology. 2010;84(15):7886-91. PubMed |
| Hansen, Scott G; Piatak, Michael Jr; Ventura, Abigail B; Hughes, Colette M; Gilbride, Roxanne M; Ford, Julia C; Oswald, Kelli; Shoemaker, Rebecca; Li, Yuan; Lewis, Matthew S; Gilliam, Awbrey N; Xu, Guangwu; Whizin, Nathan; Burwitz, Benjamin J; Planer, Shannon L; Turner, John M; Legasse, Alfred W; Axthelm, Michael K; Nelson, Jay A; Früh, Klaus; Sacha, Jonah B; Estes, Jacob D; Keele, Brandon F; Edlefsen, Paul T; Lifson, Jeffrey D; Picker, Louis J. Immune clearance of highly pathogenic SIV infection. Nature. 2013;502(7469):100-4. PubMed |
| Shin, Donghyuk; Mukherjee, Rukmini; Grewe, Diana; Bojkova, Denisa; Baek, Kheewoong; Bhattacharya, Anshu; Schulz, Laura; Widera, Marek; Mehdipour, Ahmad Reza; Tascher, Georg; Geurink, Paul P; Wilhelm, Alexander; van der Heden van Noort, Gerbrand J; Ovaa, Huib; Müller, Stefan; Knobeloch, Klaus-Peter; Rajalingam, Krishnaraj; Schulman, Brenda A; Cinatl, Jindrich; Hummer, Gerhard; Ciesek, Sandra; Dikic, Ivan. Papain-like protease regulates SARS-CoV-2 viral spread and innate immunity. Nature. 2020;587(7835):657-662. PubMed |
| Hughes, Sean M; Levy, Claire N; Calienes, Fernanda L; Stekler, Joanne D; Pandey, Urvashi; Vojtech, Lucia; Berard, Alicia R; Birse, Kenzie; Noël-Romas, Laura; Richardson, Brian; Golden, Jackelyn B; Cartwright, Michael; Collier, Ann C; Stevens, Claire E; Curlin, Marcel E; Holtz, Timothy H; Mugo, Nelly; Irungu, Elizabeth; Katabira, Elly; Muwonge, Timothy; Lama, Javier R; Baeten, Jared M; Burgener, Adam; Lingappa, Jairam R; McElrath, M Juliana; Mackelprang, Romel; McGowan, Ian; Cranston, Ross D; Cameron, Mark J; Hladik, Florian. Treatment with Commonly Used Antiretroviral Drugs Induces a Type I/III Interferon Signature in the Gut in the Absence of HIV Infection. Cell Reports. Medicine. 2020;1(6):100096. PubMed |