Anti IRS4 pAb (ATL-HPA017372)

Atlas Antibodies

Catalog No.:
ATL-HPA017372-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: insulin receptor substrate 4
Gene Name: IRS4
Alternative Gene Name: IRS-4, PY160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054667: 72%, ENSRNOG00000061499: 26%
Entrez Gene ID: 8471
Uniprot ID: O14654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVIFNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQERRRPQSRSQ
Gene Sequence NPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVIFNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQERRRPQSRSQ
Gene ID - Mouse ENSMUSG00000054667
Gene ID - Rat ENSRNOG00000061499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRS4 pAb (ATL-HPA017372)
Datasheet Anti IRS4 pAb (ATL-HPA017372) Datasheet (External Link)
Vendor Page Anti IRS4 pAb (ATL-HPA017372) at Atlas Antibodies

Documents & Links for Anti IRS4 pAb (ATL-HPA017372)
Datasheet Anti IRS4 pAb (ATL-HPA017372) Datasheet (External Link)
Vendor Page Anti IRS4 pAb (ATL-HPA017372)