Anti IRF7 pAb (ATL-HPA052757)

Atlas Antibodies

Catalog No.:
ATL-HPA052757-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interferon regulatory factor 7
Gene Name: IRF7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025498: 76%, ENSRNOG00000017414: 74%
Entrez Gene ID: 3665
Uniprot ID: Q92985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYW
Gene Sequence HPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYW
Gene ID - Mouse ENSMUSG00000025498
Gene ID - Rat ENSRNOG00000017414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRF7 pAb (ATL-HPA052757)
Datasheet Anti IRF7 pAb (ATL-HPA052757) Datasheet (External Link)
Vendor Page Anti IRF7 pAb (ATL-HPA052757) at Atlas Antibodies

Documents & Links for Anti IRF7 pAb (ATL-HPA052757)
Datasheet Anti IRF7 pAb (ATL-HPA052757) Datasheet (External Link)
Vendor Page Anti IRF7 pAb (ATL-HPA052757)
Citations for Anti IRF7 pAb (ATL-HPA052757) – 2 Found
Goeppert, Benjamin; Truckenmueller, Felicia; Ori, Alessandro; Fritz, Valerie; Albrecht, Thomas; Fraas, Angelika; Scherer, Dominique; Silos, Rosa González; Sticht, Carsten; Gretz, Norbert; Mehrabi, Arianeb; Bewerunge-Hudler, Melanie; Pusch, Stefan; Bermejo, Justo Lorenzo; Dietrich, Peter; Schirmacher, Peter; Renner, Marcus; Roessler, Stephanie. Profiling of gallbladder carcinoma reveals distinct miRNA profiles and activation of STAT1 by the tumor suppressive miRNA-145-5p. Scientific Reports. 2019;9(1):4796.  PubMed
Yin, Xin; Riva, Laura; Pu, Yuan; Martin-Sancho, Laura; Kanamune, Jun; Yamamoto, Yuki; Sakai, Kouji; Gotoh, Shimpei; Miorin, Lisa; De Jesus, Paul D; Yang, Chih-Cheng; Herbert, Kristina M; Yoh, Sunnie; Hultquist, Judd F; García-Sastre, Adolfo; Chanda, Sumit K. MDA5 Governs the Innate Immune Response to SARS-CoV-2 in Lung Epithelial Cells. Cell Reports. 2021;34(2):108628.  PubMed