Anti IRF5 pAb (ATL-HPA046700)

Atlas Antibodies

Catalog No.:
ATL-HPA046700-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interferon regulatory factor 5
Gene Name: IRF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029771: 82%, ENSRNOG00000007437: 82%
Entrez Gene ID: 3663
Uniprot ID: Q13568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEE
Gene Sequence NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEE
Gene ID - Mouse ENSMUSG00000029771
Gene ID - Rat ENSRNOG00000007437
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRF5 pAb (ATL-HPA046700)
Datasheet Anti IRF5 pAb (ATL-HPA046700) Datasheet (External Link)
Vendor Page Anti IRF5 pAb (ATL-HPA046700) at Atlas Antibodies

Documents & Links for Anti IRF5 pAb (ATL-HPA046700)
Datasheet Anti IRF5 pAb (ATL-HPA046700) Datasheet (External Link)
Vendor Page Anti IRF5 pAb (ATL-HPA046700)
Citations for Anti IRF5 pAb (ATL-HPA046700) – 1 Found
Idborg, Helena; Zandian, Arash; Ossipova, Elena; Wigren, Edvard; Preger, Charlotta; Mobarrez, Fariborz; Checa, Antonio; Sohrabian, Azita; Pucholt, Pascal; Sandling, Johanna K; Fernandes-Cerqueira, Cátia; Rönnelid, Johan; Oke, Vilija; Grosso, Giorgia; Kvarnström, Marika; Larsson, Anders; Wheelock, Craig E; Syvänen, Ann-Christine; Rönnblom, Lars; Kultima, Kim; Persson, Helena; Gräslund, Susanne; Gunnarsson, Iva; Nilsson, Peter; Svenungsson, Elisabet; Jakobsson, Per-Johan. Circulating Levels of Interferon Regulatory Factor-5 Associates With Subgroups of Systemic Lupus Erythematosus Patients. Frontiers In Immunology. 10( 31156624):1029.  PubMed