Anti IRF2BP1 pAb (ATL-HPA042164)

Atlas Antibodies

Catalog No.: ATL-HPA042164-25

Protein Description: interferon regulatory factor 2 binding protein 1
Gene Name: IRF2BP1
Alternative Gene Name: DKFZP434M154, IRF-2BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044030: 95%, ENSRNOG00000014252: 95%
Entrez Gene ID: 26145
Uniprot ID: Q8IU81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPKAVREQL
• Gene Sequence: LGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPKAVREQL
• Gene ID - Mouse: ENSMUSG00000044030
• Gene ID - Rat: ENSRNOG00000014252
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IRF2BP1 pAb (ATL-HPA042164) – 1 Found

Croner, Roland S; Stürzl, Michael; Rau, Tilman T; Metodieva, Gergana; Geppert, Carol I; Naschberger, Elisabeth; Lausen, Berthold; Metodiev, Metodi V. Quantitative proteome profiling of lymph node-positive vs. -negative colorectal carcinomas pinpoints MX1 as a marker for lymph node metastasis. International Journal Of Cancer. 2014;135(12):2878-86.