Anti IPO7 pAb (ATL-HPA019002)

Atlas Antibodies

Catalog No.: ATL-HPA019002-25

Protein Description: importin 7
Gene Name: IPO7
Alternative Gene Name: Imp7, RANBP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066232: 98%, ENSRNOG00000010427: 99%
Entrez Gene ID: 10527
Uniprot ID: O95373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY
• Gene Sequence: RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY
• Gene ID - Mouse: ENSMUSG00000066232
• Gene ID - Rat: ENSRNOG00000010427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.