Anti IPO7 pAb (ATL-HPA019002)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019002-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IPO7
Alternative Gene Name: Imp7, RANBP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066232: 98%, ENSRNOG00000010427: 99%
Entrez Gene ID: 10527
Uniprot ID: O95373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY |
| Gene Sequence | RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY |
| Gene ID - Mouse | ENSMUSG00000066232 |
| Gene ID - Rat | ENSRNOG00000010427 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IPO7 pAb (ATL-HPA019002) | |
| Datasheet | Anti IPO7 pAb (ATL-HPA019002) Datasheet (External Link) |
| Vendor Page | Anti IPO7 pAb (ATL-HPA019002) at Atlas Antibodies |
| Documents & Links for Anti IPO7 pAb (ATL-HPA019002) | |
| Datasheet | Anti IPO7 pAb (ATL-HPA019002) Datasheet (External Link) |
| Vendor Page | Anti IPO7 pAb (ATL-HPA019002) |