Anti INTS2 pAb (ATL-HPA049524)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049524-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: INTS2
Alternative Gene Name: INT2, KIAA1287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018068: 84%, ENSRNOG00000003576: 83%
Entrez Gene ID: 57508
Uniprot ID: Q9H0H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELL |
| Gene Sequence | ICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELL |
| Gene ID - Mouse | ENSMUSG00000018068 |
| Gene ID - Rat | ENSRNOG00000003576 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INTS2 pAb (ATL-HPA049524) | |
| Datasheet | Anti INTS2 pAb (ATL-HPA049524) Datasheet (External Link) |
| Vendor Page | Anti INTS2 pAb (ATL-HPA049524) at Atlas Antibodies |
| Documents & Links for Anti INTS2 pAb (ATL-HPA049524) | |
| Datasheet | Anti INTS2 pAb (ATL-HPA049524) Datasheet (External Link) |
| Vendor Page | Anti INTS2 pAb (ATL-HPA049524) |