Anti INTS12 pAb (ATL-HPA041814)

Atlas Antibodies

Catalog No.: ATL-HPA041814-25

Protein Description: integrator complex subunit 12
Gene Name: INTS12
Alternative Gene Name: INT12, PHF22, SBBI22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028016: 88%, ENSRNOG00000011844: 89%
Entrez Gene ID: 57117
Uniprot ID: Q96CB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGSNNSTT
• Gene Sequence: SSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGSNNSTT
• Gene ID - Mouse: ENSMUSG00000028016
• Gene ID - Rat: ENSRNOG00000011844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.