Anti INPP1 pAb (ATL-HPA036699)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036699-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: INPP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026102: 86%, ENSRNOG00000012375: 85%
Entrez Gene ID: 3628
Uniprot ID: P49441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVY |
| Gene Sequence | TSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVY |
| Gene ID - Mouse | ENSMUSG00000026102 |
| Gene ID - Rat | ENSRNOG00000012375 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INPP1 pAb (ATL-HPA036699) | |
| Datasheet | Anti INPP1 pAb (ATL-HPA036699) Datasheet (External Link) |
| Vendor Page | Anti INPP1 pAb (ATL-HPA036699) at Atlas Antibodies |
| Documents & Links for Anti INPP1 pAb (ATL-HPA036699) | |
| Datasheet | Anti INPP1 pAb (ATL-HPA036699) Datasheet (External Link) |
| Vendor Page | Anti INPP1 pAb (ATL-HPA036699) |