Anti INPP1 pAb (ATL-HPA036699)

Atlas Antibodies

Catalog No.:
ATL-HPA036699-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inositol polyphosphate-1-phosphatase
Gene Name: INPP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026102: 86%, ENSRNOG00000012375: 85%
Entrez Gene ID: 3628
Uniprot ID: P49441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVY
Gene Sequence TSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVY
Gene ID - Mouse ENSMUSG00000026102
Gene ID - Rat ENSRNOG00000012375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INPP1 pAb (ATL-HPA036699)
Datasheet Anti INPP1 pAb (ATL-HPA036699) Datasheet (External Link)
Vendor Page Anti INPP1 pAb (ATL-HPA036699) at Atlas Antibodies

Documents & Links for Anti INPP1 pAb (ATL-HPA036699)
Datasheet Anti INPP1 pAb (ATL-HPA036699) Datasheet (External Link)
Vendor Page Anti INPP1 pAb (ATL-HPA036699)