Anti IMPDH2 pAb (ATL-HPA001400 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001400-25

Protein Description: IMP (inosine 5'-monophosphate) dehydrogenase 2
Gene Name: IMPDH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062867: 98%, ENSRNOG00000031965: 98%
Entrez Gene ID: 3615
Uniprot ID: P12268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
• Gene Sequence: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
• Gene ID - Mouse: ENSMUSG00000062867
• Gene ID - Rat: ENSRNOG00000031965
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IMPDH2 pAb (ATL-HPA001400 w/enhanced validation) – 7 Found

Bianchi-Smiraglia, Anna; Rana, Mitra S; Foley, Colleen E; Paul, Leslie M; Lipchick, Brittany C; Moparthy, Sudha; Moparthy, Kalyana; Fink, Emily E; Bagati, Archis; Hurley, Edward; Affronti, Hayley C; Bakin, Andrei V; Kandel, Eugene S; Smiraglia, Dominic J; Feltri, Maria Laura; Sousa, Rui; Nikiforov, Mikhail A. Internally ratiometric fluorescent sensors for evaluation of intracellular GTP levels and distribution. Nature Methods. 2017;14(10):1003-1009. 

Mannava, Sudha; Grachtchouk, Vladimir; Wheeler, Linda J; Im, Michael; Zhuang, Dazhong; Slavina, Elena G; Mathews, Christopher K; Shewach, Donna S; Nikiforov, Mikhail A. Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells. Cell Cycle (Georgetown, Tex.). 2008;7(15):2392-400. 

Floryk, Daniel; Thompson, Timothy C. Antiproliferative effects of AVN944, a novel inosine 5-monophosphate dehydrogenase inhibitor, in prostate cancer cells. International Journal Of Cancer. 2008;123(10):2294-302. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Wawrzyniak, Joseph A; Bianchi-Smiraglia, Anna; Bshara, Wiam; Mannava, Sudha; Ackroyd, Jeff; Bagati, Archis; Omilian, Angela R; Im, Michael; Fedtsova, Natalia; Miecznikowski, Jeffrey C; Moparthy, Kalyana C; Zucker, Shoshanna N; Zhu, Qianqian; Kozlova, Nadezhda I; Berman, Albert E; Hoek, Keith S; Gudkov, Andrei V; Shewach, Donna S; Morrison, Carl D; Nikiforov, Mikhail A. A purine nucleotide biosynthesis enzyme guanosine monophosphate reductase is a suppressor of melanoma invasion. Cell Reports. 2013;5(2):493-507. 

Barfeld, Stefan J; Fazli, Ladan; Persson, Margareta; Marjavaara, Lisette; Urbanucci, Alfonso; Kaukoniemi, Kirsi M; Rennie, Paul S; Ceder, Yvonne; Chabes, Andrei; Visakorpi, Tapio; Mills, Ian G. Myc-dependent purine biosynthesis affects nucleolar stress and therapy response in prostate cancer. Oncotarget. 2015;6(14):12587-602. 

Bianchi-Smiraglia, Anna; Wolff, David W; Marston, Daniel J; Deng, Zhiyong; Han, Zhannan; Moparthy, Sudha; Wombacher, Rebecca M; Mussell, Ashley L; Shen, Shichen; Chen, Jialin; Yun, Dong-Hyun; O'Brien Cox, Anderson; Furdui, Cristina M; Hurley, Edward; Feltri, Maria Laura; Qu, Jun; Hollis, Thomas; Kengne, Jules Berlin Nde; Fongang, Bernard; Sousa, Rui J; Kandel, Mikhail E; Kandel, Eugene S; Hahn, Klaus M; Nikiforov, Mikhail A. Regulation of local GTP availability controls RAC1 activity and cell invasion. Nature Communications. 2021;12(1):6091.