Anti IL20RA pAb (ATL-HPA042281)

Atlas Antibodies

Catalog No.:
ATL-HPA042281-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: interleukin 20 receptor, alpha
Gene Name: IL20RA
Alternative Gene Name: IL-20R1, ZCYTOR7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020007: 80%, ENSRNOG00000012286: 76%
Entrez Gene ID: 53832
Uniprot ID: Q9UHF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK
Gene Sequence DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK
Gene ID - Mouse ENSMUSG00000020007
Gene ID - Rat ENSRNOG00000012286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL20RA pAb (ATL-HPA042281)
Datasheet Anti IL20RA pAb (ATL-HPA042281) Datasheet (External Link)
Vendor Page Anti IL20RA pAb (ATL-HPA042281) at Atlas Antibodies

Documents & Links for Anti IL20RA pAb (ATL-HPA042281)
Datasheet Anti IL20RA pAb (ATL-HPA042281) Datasheet (External Link)
Vendor Page Anti IL20RA pAb (ATL-HPA042281)