Anti IL1RL1 pAb (ATL-HPA007917)

Atlas Antibodies

Catalog No.: ATL-HPA007917-25

Protein Description: interleukin 1 receptor-like 1
Gene Name: IL1RL1
Alternative Gene Name: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026069: 69%, ENSRNOG00000014835: 66%
Entrez Gene ID: 9173
Uniprot ID: Q01638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
• Gene Sequence: PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
• Gene ID - Mouse: ENSMUSG00000026069
• Gene ID - Rat: ENSRNOG00000014835
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL1RL1 pAb (ATL-HPA007917) – 1 Found

Lin, Lin; Li, Yang; Liu, Mingli; Li, Qingbin; Liu, Quan; Li, Ruiyan. The Interleukin-33/ST2 axis promotes glioma mesenchymal transition, stemness and TMZ resistance via JNK activation. Aging. 2020;12(2):1685-1703.