Anti IL1RAP pAb (ATL-HPA035293)

Atlas Antibodies

Catalog No.: ATL-HPA035293-25

Protein Description: interleukin 1 receptor accessory protein
Gene Name: IL1RAP
Alternative Gene Name: C3orf13, IL-1RAcP, IL1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022514: 85%, ENSRNOG00000001928: 85%
Entrez Gene ID: 3556
Uniprot ID: Q9NPH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
• Gene Sequence: CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
• Gene ID - Mouse: ENSMUSG00000022514
• Gene ID - Rat: ENSRNOG00000001928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.