Anti IL1RAP pAb (ATL-HPA035293)

Atlas Antibodies

Catalog No.:
ATL-HPA035293-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: interleukin 1 receptor accessory protein
Gene Name: IL1RAP
Alternative Gene Name: C3orf13, IL-1RAcP, IL1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022514: 85%, ENSRNOG00000001928: 85%
Entrez Gene ID: 3556
Uniprot ID: Q9NPH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
Gene Sequence CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
Gene ID - Mouse ENSMUSG00000022514
Gene ID - Rat ENSRNOG00000001928
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL1RAP pAb (ATL-HPA035293)
Datasheet Anti IL1RAP pAb (ATL-HPA035293) Datasheet (External Link)
Vendor Page Anti IL1RAP pAb (ATL-HPA035293) at Atlas Antibodies

Documents & Links for Anti IL1RAP pAb (ATL-HPA035293)
Datasheet Anti IL1RAP pAb (ATL-HPA035293) Datasheet (External Link)
Vendor Page Anti IL1RAP pAb (ATL-HPA035293)