Anti IL18 pAb (ATL-HPA003980 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003980-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: interleukin 18
Gene Name: IL18
Alternative Gene Name: IGIF, IL-18, IL-1g, IL1F4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039217: 61%, ENSRNOG00000009848: 62%
Entrez Gene ID: 3606
Uniprot ID: Q14116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQF
Gene Sequence MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQF
Gene ID - Mouse ENSMUSG00000039217
Gene ID - Rat ENSRNOG00000009848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL18 pAb (ATL-HPA003980 w/enhanced validation)
Datasheet Anti IL18 pAb (ATL-HPA003980 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL18 pAb (ATL-HPA003980 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IL18 pAb (ATL-HPA003980 w/enhanced validation)
Datasheet Anti IL18 pAb (ATL-HPA003980 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL18 pAb (ATL-HPA003980 w/enhanced validation)
Citations for Anti IL18 pAb (ATL-HPA003980 w/enhanced validation) – 9 Found
Briend, Emmanuel; Ferguson, G John; Mori, Michiko; Damera, Gautam; Stephenson, Katherine; Karp, Natasha A; Sethi, Sanjay; Ward, Christine K; Sleeman, Matthew A; Erjefält, Jonas S; Finch, Donna K. IL-18 associated with lung lymphoid aggregates drives IFNγ production in severe COPD. Respiratory Research. 2017;18(1):159.  PubMed
Joas, Simone; Parrish, Erica H; Gnanadurai, Clement W; Lump, Edina; Stürzel, Christina M; Parrish, Nicholas F; Learn, Gerald H; Sauermann, Ulrike; Neumann, Berit; Rensing, Kerstin Mätz; Fuchs, Dietmar; Billingsley, James M; Bosinger, Steven E; Silvestri, Guido; Apetrei, Cristian; Huot, Nicolas; Garcia-Tellez, Thalia; Müller-Trutwin, Michaela; Hotter, Dominik; Sauter, Daniel; Stahl-Hennig, Christiane; Hahn, Beatrice H; Kirchhoff, Frank. Species-specific host factors rather than virus-intrinsic virulence determine primate lentiviral pathogenicity. Nature Communications. 2018;9(1):1371.  PubMed
Estes, Jacob D; Harris, Levelle D; Klatt, Nichole R; Tabb, Brian; Pittaluga, Stefania; Paiardini, Mirko; Barclay, G Robin; Smedley, Jeremy; Pung, Rhonda; Oliveira, Kenneth M; Hirsch, Vanessa M; Silvestri, Guido; Douek, Daniel C; Miller, Christopher J; Haase, Ashley T; Lifson, Jeffrey; Brenchley, Jason M. Damaged intestinal epithelial integrity linked to microbial translocation in pathogenic simian immunodeficiency virus infections. Plos Pathogens. 2010;6(8):e1001052.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Cameron, S A; White, S M; Arrollo, D; Shulman, S T; Rowley, A H. Arterial immune protein expression demonstrates the complexity of immune responses in Kawasaki disease arteritis. Clinical And Experimental Immunology. 2017;190(2):244-250.  PubMed
Barsalou, Julie; Blincoe, Annaliesse; Fernandez, Isabel; Dal-Soglio, Dorothée; Marchitto, Lorie; Selleri, Silvia; Haddad, Elie; Benyoucef, Aissa; Touzot, Fabien. Rapamycin as an Adjunctive Therapy for NLRC4 Associated Macrophage Activation Syndrome. Frontiers In Immunology. 9( 30319625):2162.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Chakravarti, Deepavali; Hu, Baoli; Mao, Xizeng; Rashid, Asif; Li, Jiexi; Li, Jun; Liao, Wen-Ting; Whitley, Elizabeth M; Dey, Prasenjit; Hou, Pingping; LaBella, Kyle A; Chang, Andrew; Wang, Guocan; Spring, Denise J; Deng, Pingna; Zhao, Di; Liang, Xin; Lan, Zhengdao; Lin, Yiyun; Sarkar, Sharmistha; Terranova, Christopher; Deribe, Yonathan Lissanu; Blutt, Sarah E; Okhuysen, Pablo; Zhang, Jianhua; Vilar, Eduardo; Nielsen, Ole Haagen; Dupont, Andrew; Younes, Mamoun; Patel, Kalyani R; Shroyer, Noah F; Rai, Kunal; Estes, Mary K; Wang, Y Alan; Bertuch, Alison A; DePinho, Ronald A. Telomere dysfunction activates YAP1 to drive tissue inflammation. Nature Communications. 2020;11(1):4766.  PubMed
Lapiere, Alexia; Geiger, Mallia; Robert, Véronique; Demarquay, Christelle; Auger, Sandrine; Chadi, Sead; Benadjaoud, Mohamedamine; Fernandes, Gabriel; Milliat, Fabien; Langella, Philippe; Benderitter, Marc; Chatel, Jean-Marc; Sémont, Alexandra. Prophylactic Faecalibacterium prausnitzii treatment prevents the acute breakdown of colonic epithelial barrier in a preclinical model of pelvic radiation disease. Gut Microbes. 2020;12(1):1-15.  PubMed