Anti IL11RA pAb (ATL-HPA013162)

Atlas Antibodies

Catalog No.:
ATL-HPA013162-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin 11 receptor, alpha
Gene Name: IL11RA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073889: 83%, ENSRNOG00000015068: 80%
Entrez Gene ID: 3590
Uniprot ID: Q14626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRL
Gene Sequence VESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRL
Gene ID - Mouse ENSMUSG00000073889
Gene ID - Rat ENSRNOG00000015068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL11RA pAb (ATL-HPA013162)
Datasheet Anti IL11RA pAb (ATL-HPA013162) Datasheet (External Link)
Vendor Page Anti IL11RA pAb (ATL-HPA013162) at Atlas Antibodies

Documents & Links for Anti IL11RA pAb (ATL-HPA013162)
Datasheet Anti IL11RA pAb (ATL-HPA013162) Datasheet (External Link)
Vendor Page Anti IL11RA pAb (ATL-HPA013162)