Anti IKZF3 pAb (ATL-HPA024377 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024377-25

Protein Description: IKAROS family zinc finger 3 (Aiolos)
Gene Name: IKZF3
Alternative Gene Name: Aiolos, ZNFN1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018168: 77%, ENSRNOG00000007200: 77%
Entrez Gene ID: 22806
Uniprot ID: Q9UKT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVL
• Gene Sequence: AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVL
• Gene ID - Mouse: ENSMUSG00000018168
• Gene ID - Rat: ENSRNOG00000007200
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IKZF3 pAb (ATL-HPA024377 w/enhanced validation) – 1 Found

Gleber-Netto, Frederico O; Rao, Xiayu; Guo, Theresa; Xi, Yuanxin; Gao, Meng; Shen, Li; Erikson, Kelly; Kalu, Nene N; Ren, Shuling; Xu, Guorong; Fisch, Kathleen M; Akagi, Keiko; Seiwert, Tanguy; Gillison, Maura; Frederick, Mitchell J; Johnson, Faye M; Wang, Jing; Myers, Jeffrey N; Califano, Joseph; Skinner, Heath D; Pickering, Curtis R. Variations in HPV function are associated with survival in squamous cell carcinoma. Jci Insight. 2019;4(1)