Anti IKBKAP pAb (ATL-HPA049677)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049677-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: IKBKAP
Alternative Gene Name: DYS, ELP1, IKAP, IKI3, TOT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028431: 73%, ENSRNOG00000016725: 76%
Entrez Gene ID: 8518
Uniprot ID: O95163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD |
Gene Sequence | NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD |
Gene ID - Mouse | ENSMUSG00000028431 |
Gene ID - Rat | ENSRNOG00000016725 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IKBKAP pAb (ATL-HPA049677) | |
Datasheet | Anti IKBKAP pAb (ATL-HPA049677) Datasheet (External Link) |
Vendor Page | Anti IKBKAP pAb (ATL-HPA049677) at Atlas Antibodies |
Documents & Links for Anti IKBKAP pAb (ATL-HPA049677) | |
Datasheet | Anti IKBKAP pAb (ATL-HPA049677) Datasheet (External Link) |
Vendor Page | Anti IKBKAP pAb (ATL-HPA049677) |