Anti IK pAb (ATL-HPA048798)

Atlas Antibodies

Catalog No.:
ATL-HPA048798-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: IK cytokine, down-regulator of HLA II
Gene Name: IK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024474: 99%, ENSRNOG00000017251: 100%
Entrez Gene ID: 3550
Uniprot ID: Q13123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPK
Gene Sequence DMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPK
Gene ID - Mouse ENSMUSG00000024474
Gene ID - Rat ENSRNOG00000017251
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IK pAb (ATL-HPA048798)
Datasheet Anti IK pAb (ATL-HPA048798) Datasheet (External Link)
Vendor Page Anti IK pAb (ATL-HPA048798) at Atlas Antibodies

Documents & Links for Anti IK pAb (ATL-HPA048798)
Datasheet Anti IK pAb (ATL-HPA048798) Datasheet (External Link)
Vendor Page Anti IK pAb (ATL-HPA048798)