Anti IGFL4 pAb (ATL-HPA047655)

Atlas Antibodies

Catalog No.:
ATL-HPA047655-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: IGF-like family member 4
Gene Name: IGFL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066756: 32%, ENSRNOG00000032940: 32%
Entrez Gene ID: 444882
Uniprot ID: Q6B9Z1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI
Gene Sequence FWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI
Gene ID - Mouse ENSMUSG00000066756
Gene ID - Rat ENSRNOG00000032940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGFL4 pAb (ATL-HPA047655)
Datasheet Anti IGFL4 pAb (ATL-HPA047655) Datasheet (External Link)
Vendor Page Anti IGFL4 pAb (ATL-HPA047655) at Atlas Antibodies

Documents & Links for Anti IGFL4 pAb (ATL-HPA047655)
Datasheet Anti IGFL4 pAb (ATL-HPA047655) Datasheet (External Link)
Vendor Page Anti IGFL4 pAb (ATL-HPA047655)