Anti IFNGR2 pAb (ATL-HPA001535 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001535-25

Protein Description: interferon gamma receptor 2 (interferon gamma transducer 1)
Gene Name: IFNGR2
Alternative Gene Name: AF-1, IFNGT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022965: 57%, ENSRNOG00000002032: 57%
Entrez Gene ID: 3460
Uniprot ID: P38484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
• Gene Sequence: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
• Gene ID - Mouse: ENSMUSG00000022965
• Gene ID - Rat: ENSRNOG00000002032
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFNGR2 pAb (ATL-HPA001535 w/enhanced validation) – 2 Found

Roth, Sofia; Spalinger, Marianne R; Gottier, Claudia; Biedermann, Luc; Zeitz, Jonas; Lang, Silvia; Weber, Achim; Rogler, Gerhard; Scharl, Michael. Bilberry-Derived Anthocyanins Modulate Cytokine Expression in the Intestine of Patients with Ulcerative Colitis. Plos One. 11(5):e0154817. 

Ivanidze, Jana; Hoffmann, Reinhard; Lochmüller, Hanns; Engel, Andrew G; Hohlfeld, Reinhard; Dornmair, Klaus. Inclusion body myositis: laser microdissection reveals differential up-regulation of IFN-γ signaling cascade in attacked versus nonattacked myofibers. The American Journal Of Pathology. 2011;179(3):1347-59.