Anti IFITM3 pAb (ATL-HPA004337 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004337-25

Protein Description: interferon induced transmembrane protein 3
Gene Name: IFITM3
Alternative Gene Name: 1-8U
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025492: 58%, ENSRNOG00000015078: 58%
Entrez Gene ID: 10410
Uniprot ID: Q01628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
• Gene Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
• Gene ID - Mouse: ENSMUSG00000025492
• Gene ID - Rat: ENSRNOG00000015078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFITM3 pAb (ATL-HPA004337 w/enhanced validation) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Wang, Yi-Song; Luo, Qiao-Li; Guan, Yu-Guang; Fan, Dong-Ying; Luan, Guo-Ming; Jing, An. HCMV infection and IFITM3 rs12252 are associated with Rasmussen's encephalitis disease progression. Annals Of Clinical And Translational Neurology. 2021;8(3):558-570.