Anti IFI44 pAb (ATL-HPA043858)

Atlas Antibodies

Catalog No.:
ATL-HPA043858-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: interferon-induced protein 44
Gene Name: IFI44
Alternative Gene Name: MTAP44, p44, TLDC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028037: 60%, ENSRNOG00000022218: 59%
Entrez Gene ID: 10561
Uniprot ID: Q8TCB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELD
Gene Sequence CVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELD
Gene ID - Mouse ENSMUSG00000028037
Gene ID - Rat ENSRNOG00000022218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IFI44 pAb (ATL-HPA043858)
Datasheet Anti IFI44 pAb (ATL-HPA043858) Datasheet (External Link)
Vendor Page Anti IFI44 pAb (ATL-HPA043858) at Atlas Antibodies

Documents & Links for Anti IFI44 pAb (ATL-HPA043858)
Datasheet Anti IFI44 pAb (ATL-HPA043858) Datasheet (External Link)
Vendor Page Anti IFI44 pAb (ATL-HPA043858)
Citations for Anti IFI44 pAb (ATL-HPA043858) – 1 Found
Fernbach, Sonja; Spieler, Eva E; Busnadiego, Idoia; Karakus, Umut; Lkharrazi, Anouk; Stertz, Silke; Hale, Benjamin G. Restriction factor screening identifies RABGAP1L-mediated disruption of endocytosis as a host antiviral defense. Cell Reports. 2022;38(12):110549.  PubMed