Anti IFI44 pAb (ATL-HPA043858)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043858-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: IFI44
Alternative Gene Name: MTAP44, p44, TLDC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028037: 60%, ENSRNOG00000022218: 59%
Entrez Gene ID: 10561
Uniprot ID: Q8TCB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELD |
| Gene Sequence | CVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELD |
| Gene ID - Mouse | ENSMUSG00000028037 |
| Gene ID - Rat | ENSRNOG00000022218 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IFI44 pAb (ATL-HPA043858) | |
| Datasheet | Anti IFI44 pAb (ATL-HPA043858) Datasheet (External Link) |
| Vendor Page | Anti IFI44 pAb (ATL-HPA043858) at Atlas Antibodies |
| Documents & Links for Anti IFI44 pAb (ATL-HPA043858) | |
| Datasheet | Anti IFI44 pAb (ATL-HPA043858) Datasheet (External Link) |
| Vendor Page | Anti IFI44 pAb (ATL-HPA043858) |
| Citations for Anti IFI44 pAb (ATL-HPA043858) – 1 Found |
| Fernbach, Sonja; Spieler, Eva E; Busnadiego, Idoia; Karakus, Umut; Lkharrazi, Anouk; Stertz, Silke; Hale, Benjamin G. Restriction factor screening identifies RABGAP1L-mediated disruption of endocytosis as a host antiviral defense. Cell Reports. 2022;38(12):110549. PubMed |