Anti IFI35 pAb (ATL-HPA045946)

Atlas Antibodies

Catalog No.:
ATL-HPA045946-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: interferon-induced protein 35
Gene Name: IFI35
Alternative Gene Name: IFP35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010358: 76%, ENSRNOG00000020678: 77%
Entrez Gene ID: 3430
Uniprot ID: P80217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Gene Sequence VDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Gene ID - Mouse ENSMUSG00000010358
Gene ID - Rat ENSRNOG00000020678
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IFI35 pAb (ATL-HPA045946)
Datasheet Anti IFI35 pAb (ATL-HPA045946) Datasheet (External Link)
Vendor Page Anti IFI35 pAb (ATL-HPA045946) at Atlas Antibodies

Documents & Links for Anti IFI35 pAb (ATL-HPA045946)
Datasheet Anti IFI35 pAb (ATL-HPA045946) Datasheet (External Link)
Vendor Page Anti IFI35 pAb (ATL-HPA045946)